Lineage for d1js2d1 (1js2 D:305-389)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586270Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 2586271Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 2586272Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 2586273Protein HIPIP (high potential iron protein) [57654] (9 species)
  7. 2586276Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries)
  8. 2586283Domain d1js2d1: 1js2 D:305-389 [67214]
    Other proteins in same PDB: d1js2a2, d1js2b2, d1js2c2, d1js2d2
    complexed with sf4

Details for d1js2d1

PDB Entry: 1js2 (more details), 1.9 Å

PDB Description: Crystal structure of C77S HiPIP: a serine ligated [4Fe-4S] cluster
PDB Compounds: (D:) high-potential iron protein

SCOPe Domain Sequences for d1js2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1js2d1 g.35.1.1 (D:305-389) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId: 1049]}
sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
kgcqlfpgklinvngwsaswtlkag

SCOPe Domain Coordinates for d1js2d1:

Click to download the PDB-style file with coordinates for d1js2d1.
(The format of our PDB-style files is described here.)

Timeline for d1js2d1: