Lineage for d1js2c1 (1js2 C:205-289)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261760Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 2261761Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 2261762Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 2261763Protein HIPIP (high potential iron protein) [57654] (9 species)
  7. 2261766Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries)
  8. 2261772Domain d1js2c1: 1js2 C:205-289 [67213]
    Other proteins in same PDB: d1js2a2, d1js2b2, d1js2c2, d1js2d2
    complexed with sf4

Details for d1js2c1

PDB Entry: 1js2 (more details), 1.9 Å

PDB Description: Crystal structure of C77S HiPIP: a serine ligated [4Fe-4S] cluster
PDB Compounds: (C:) high-potential iron protein

SCOPe Domain Sequences for d1js2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1js2c1 g.35.1.1 (C:205-289) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId: 1049]}
sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
kgcqlfpgklinvngwsaswtlkag

SCOPe Domain Coordinates for d1js2c1:

Click to download the PDB-style file with coordinates for d1js2c1.
(The format of our PDB-style files is described here.)

Timeline for d1js2c1: