Lineage for d1jrzb1 (1jrz B:1-102)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286371Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 286372Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 286439Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 286468Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 286469Species Shewanella frigidimarina [TaxId:56812] [48722] (10 PDB entries)
  8. 286482Domain d1jrzb1: 1jrz B:1-102 [67208]
    Other proteins in same PDB: d1jrza2, d1jrza3, d1jrzb2, d1jrzb3
    complexed with fad, fum, hem, na; mutant

Details for d1jrzb1

PDB Entry: 1jrz (more details), 2 Å

PDB Description: crystal structure of arg402tyr mutant flavocytochrome c3 from shewanella frigidimarina

SCOP Domain Sequences for d1jrzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrzb1 a.138.1.3 (B:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

SCOP Domain Coordinates for d1jrzb1:

Click to download the PDB-style file with coordinates for d1jrzb1.
(The format of our PDB-style files is described here.)

Timeline for d1jrzb1: