Lineage for d1jryb2 (1jry B:103-359,B:506-568)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849779Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 2849786Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
    contains additional N-terminal multiheme domain
  7. 2849787Species Shewanella frigidimarina [TaxId:56812] [51941] (16 PDB entries)
  8. 2849798Domain d1jryb2: 1jry B:103-359,B:506-568 [67203]
    Other proteins in same PDB: d1jrya1, d1jrya3, d1jryb1, d1jryb3
    complexed with fad, fum, hem, na; mutant

Details for d1jryb2

PDB Entry: 1jry (more details), 2 Å

PDB Description: crystal structure of arg402lys mutant flavocytochrome c3 from shewanella frigidimarina
PDB Compounds: (B:) flavocytochrome c

SCOPe Domain Sequences for d1jryb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jryb2 c.3.1.4 (B:103-359,B:506-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
ptiaelakdkserqaalasaphdtvdvvvvgsggagfsaaisatdsgakviliekepvig
gnaklaaggmnaawtdqqkakkitdspelmfedtmkggqnindpalvkvlsshskdsvdw
mtamgadltdvgmmggasvnrahrptggagvgahvvqvlydnavkrnidlrmntrgievl
kddkgtvkgilvkgmykgyywvkadavilatggfaknnervakldpslkgfistnqpgav
gdgldvaenaggalkdmXtmggvmidtkaevmnakkqvipglygagevtggvhganrlgg
naisdiitfgrlageeaakys

SCOPe Domain Coordinates for d1jryb2:

Click to download the PDB-style file with coordinates for d1jryb2.
(The format of our PDB-style files is described here.)

Timeline for d1jryb2: