Lineage for d1jryb1 (1jry B:1-102)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544896Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 544897Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 544980Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 545009Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 545010Species Shewanella frigidimarina [TaxId:56812] [48722] (13 PDB entries)
  8. 545019Domain d1jryb1: 1jry B:1-102 [67202]
    Other proteins in same PDB: d1jrya2, d1jrya3, d1jryb2, d1jryb3
    complexed with fad, fum, hem, na; mutant

Details for d1jryb1

PDB Entry: 1jry (more details), 2 Å

PDB Description: crystal structure of arg402lys mutant flavocytochrome c3 from shewanella frigidimarina

SCOP Domain Sequences for d1jryb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jryb1 a.138.1.3 (B:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

SCOP Domain Coordinates for d1jryb1:

Click to download the PDB-style file with coordinates for d1jryb1.
(The format of our PDB-style files is described here.)

Timeline for d1jryb1: