Lineage for d1jrxb3 (1jrx B:360-505)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442462Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 1442463Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 1442464Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 1442471Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
    contains additional N-terminal multiheme domain
  7. 1442472Species Shewanella frigidimarina [TaxId:56812] [56433] (16 PDB entries)
  8. 1442491Domain d1jrxb3: 1jrx B:360-505 [67198]
    Other proteins in same PDB: d1jrxa1, d1jrxa2, d1jrxb1, d1jrxb2
    complexed with fad, fum, hem, na; mutant

Details for d1jrxb3

PDB Entry: 1jrx (more details), 2 Å

PDB Description: crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina
PDB Compounds: (B:) flavocytochrome c

SCOPe Domain Sequences for d1jrxb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrxb3 d.168.1.1 (B:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
qyiqahptlsvkggvmvteavrgngailvnregkrfvneittadkasaailaqtgksayl
ifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtd
ferpnlpralnegnyyaievtpgvhh

SCOPe Domain Coordinates for d1jrxb3:

Click to download the PDB-style file with coordinates for d1jrxb3.
(The format of our PDB-style files is described here.)

Timeline for d1jrxb3: