SCOPe 2.05: Domain d1jrxb1: 1jrx B:1-102

Lineage for d1jrxb1 (1jrx B:1-102)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)

7. Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries)

8. Domain d1jrxb1: 1jrx B:1-102 [67196]
   Other proteins in same PDB: d1jrxa2, d1jrxa3, d1jrxb2, d1jrxb3
   complexed with fad, fum, hem, na; mutant

Details for d1jrxb1

PDB Entry: 1jrx, 2 Å

PDB Description: crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina

PDB Compounds: (B:) flavocytochrome c

SCOPe Domain Sequences for d1jrxb1:

Sequence; same for both SEQRES and ATOM records:

>d1jrxb1 a.138.1.3 (B:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

Timeline for d1jrxb1:

• d1jrxb1 first appeared in SCOP 1.59
  
• d1jrxb1 appears in SCOPe 2.04
  
• d1jrxb1 appears in SCOPe 2.06
  
• d1jrxb1 appears in the current release, SCOPe 2.08