SCOP 1.59: Domain d1jrxa1: 1jrx A:1-102

Lineage for d1jrxa1 (1jrx A:1-102)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)

5. Family a.138.1.3: Di-heme elbow motif [48711] (5 proteins)

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (2 species)

7. Species Shewanella frigidimarina [TaxId:56812] [48722] (6 PDB entries)

8. Domain d1jrxa1: 1jrx A:1-102 [67193]
   Other proteins in same PDB: d1jrxa2, d1jrxa3, d1jrxb2, d1jrxb3

Details for d1jrxa1

PDB Entry: 1jrx, 2 Å

PDB Description: crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina

SCOP Domain Sequences for d1jrxa1:

Sequence; same for both SEQRES and ATOM records:

>d1jrxa1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

Timeline for d1jrxa1:

• d1jrxa1 is new in SCOP 1.59
  
• d1jrxa1 appears in SCOP 1.61
  
• d1jrxa1 appears in the current release, SCOPe 2.08