Lineage for d1jrqb4 (1jrq B:6-90)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259449Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 259450Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 259451Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 259452Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 259453Species Escherichia coli [TaxId:562] [55386] (10 PDB entries)
  8. 259463Domain d1jrqb4: 1jrq B:6-90 [67192]
    Other proteins in same PDB: d1jrqa1, d1jrqa2, d1jrqa3, d1jrqb1, d1jrqb2, d1jrqb3
    complexed with ca, cu; mutant

Details for d1jrqb4

PDB Entry: 1jrq (more details), 2.15 Å

PDB Description: x-ray structure analysis of the role of the conserved tyrosine-369 in active site of e. coli amine oxidase
PDB Compounds: (B:)

SCOP Domain Sequences for d1jrqb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrqb4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1jrqb4:

Click to download the PDB-style file with coordinates for d1jrqb4.
(The format of our PDB-style files is described here.)

Timeline for d1jrqb4: