Lineage for d1jrqb3 (1jrq B:186-300)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500605Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 500682Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 500683Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 500684Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 500732Species Escherichia coli [TaxId:562] [54419] (11 PDB entries)
  8. 500752Domain d1jrqb3: 1jrq B:186-300 [67191]
    Other proteins in same PDB: d1jrqa1, d1jrqa4, d1jrqb1, d1jrqb4

Details for d1jrqb3

PDB Entry: 1jrq (more details), 2.15 Å

PDB Description: x-ray structure analysis of the role of the conserved tyrosine-369 in active site of e. coli amine oxidase

SCOP Domain Sequences for d1jrqb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrqb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOP Domain Coordinates for d1jrqb3:

Click to download the PDB-style file with coordinates for d1jrqb3.
(The format of our PDB-style files is described here.)

Timeline for d1jrqb3: