Lineage for d1jrqb1 (1jrq B:301-726)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782205Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1782206Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1782207Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1782273Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 1782289Domain d1jrqb1: 1jrq B:301-726 [67189]
    Other proteins in same PDB: d1jrqa2, d1jrqa3, d1jrqa4, d1jrqb2, d1jrqb3, d1jrqb4
    complexed with ca, cu

Details for d1jrqb1

PDB Entry: 1jrq (more details), 2.15 Å

PDB Description: x-ray structure analysis of the role of the conserved tyrosine-369 in active site of e. coli amine oxidase
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1jrqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrqb1 b.30.2.1 (B:301-726) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpfgdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkkd

SCOPe Domain Coordinates for d1jrqb1:

Click to download the PDB-style file with coordinates for d1jrqb1.
(The format of our PDB-style files is described here.)

Timeline for d1jrqb1: