Lineage for d1jrqa3 (1jrq A:186-300)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 408949Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 408950Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 408951Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 408995Species Escherichia coli [TaxId:562] [54419] (11 PDB entries)
  8. 409013Domain d1jrqa3: 1jrq A:186-300 [67187]
    Other proteins in same PDB: d1jrqa1, d1jrqa4, d1jrqb1, d1jrqb4

Details for d1jrqa3

PDB Entry: 1jrq (more details), 2.15 Å

PDB Description: x-ray structure analysis of the role of the conserved tyrosine-369 in active site of e. coli amine oxidase

SCOP Domain Sequences for d1jrqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrqa3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOP Domain Coordinates for d1jrqa3:

Click to download the PDB-style file with coordinates for d1jrqa3.
(The format of our PDB-style files is described here.)

Timeline for d1jrqa3: