Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Escherichia coli [TaxId:562] [54419] (11 PDB entries) |
Domain d1jrqa2: 1jrq A:91-185 [67186] Other proteins in same PDB: d1jrqa1, d1jrqa4, d1jrqb1, d1jrqb4 |
PDB Entry: 1jrq (more details), 2.15 Å
SCOP Domain Sequences for d1jrqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrqa2 d.17.2.1 (A:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli} krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr kadvimldgkhiieavvdlqnnkllswqpikdahg
Timeline for d1jrqa2:
View in 3D Domains from other chains: (mouse over for more information) d1jrqb1, d1jrqb2, d1jrqb3, d1jrqb4 |