Lineage for d1jrqa1 (1jrq A:301-724)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165117Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 165118Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 165119Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 165132Species Escherichia coli [TaxId:562] [50001] (10 PDB entries)
  8. 165141Domain d1jrqa1: 1jrq A:301-724 [67185]
    Other proteins in same PDB: d1jrqa2, d1jrqa3, d1jrqa4, d1jrqb2, d1jrqb3, d1jrqb4

Details for d1jrqa1

PDB Entry: 1jrq (more details), 2.15 Å

PDB Description: x-ray structure analysis of the role of the conserved tyrosine-369 in active site of e. coli amine oxidase
PDB Compounds: (A:)

SCOP Domain Sequences for d1jrqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrqa1 b.30.2.1 (A:301-724) Copper amine oxidase, domain 3 (catalytic) {Escherichia coli}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpfgdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnadyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galk

SCOP Domain Coordinates for d1jrqa1:

Click to download the PDB-style file with coordinates for d1jrqa1.
(The format of our PDB-style files is described here.)

Timeline for d1jrqa1: