Lineage for d1jrph1 (1jrp H:2-123)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2188936Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2188937Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2188981Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species)
  7. 2188982Species Rhodobacter capsulatus [TaxId:1061] [69692] (4 PDB entries)
  8. 2188998Domain d1jrph1: 1jrp H:2-123 [67183]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa3, d1jrpa4, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc3, d1jrpc4, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe3, d1jrpe4, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg3, d1jrpg4, d1jrph2
    complexed with 141, ca, fad, fes, mos, mte

Details for d1jrph1

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
PDB Compounds: (H:) xanthine dehydrogenase, chain B

SCOPe Domain Sequences for d1jrph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrph1 d.41.1.1 (H:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
pr

SCOPe Domain Coordinates for d1jrph1:

Click to download the PDB-style file with coordinates for d1jrph1.
(The format of our PDB-style files is described here.)

Timeline for d1jrph1: