Lineage for d1jrpg2 (1jrp G:1-84)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 131113Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (8 proteins)
  6. 131152Protein Xanthine dehydrogenase chain A, N-terminal domain [69666] (1 species)
  7. 131153Species Rhodobacter capsulatus [TaxId:1061] [69667] (2 PDB entries)
  8. 131161Domain d1jrpg2: 1jrp G:1-84 [67180]
    Other proteins in same PDB: d1jrpa1, d1jrpa3, d1jrpa4, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc3, d1jrpc4, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe3, d1jrpe4, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg3, d1jrpg4, d1jrph1, d1jrph2

Details for d1jrpg2

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus

SCOP Domain Sequences for d1jrpg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpg2 d.15.4.2 (G:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus}
meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
naclmmlpqiagkalrtiegiaap

SCOP Domain Coordinates for d1jrpg2:

Click to download the PDB-style file with coordinates for d1jrpg2.
(The format of our PDB-style files is described here.)

Timeline for d1jrpg2: