Lineage for d1jrpe4 (1jrp E:179-345)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675806Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1675836Protein Xanthine dehydrogenase chain A, domain 3 [69829] (1 species)
  7. 1675837Species Rhodobacter capsulatus [TaxId:1061] [69830] (2 PDB entries)
  8. 1675844Domain d1jrpe4: 1jrp E:179-345 [67176]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa3, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc3, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe3, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg3, d1jrph1, d1jrph2
    complexed with 141, ca, fad, fes, mos, mpn

Details for d1jrpe4

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
PDB Compounds: (E:) xanthine dehydrogenase, chain A

SCOPe Domain Sequences for d1jrpe4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpe4 d.145.1.3 (E:179-345) Xanthine dehydrogenase chain A, domain 3 {Rhodobacter capsulatus [TaxId: 1061]}
paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp
dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal
iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa

SCOPe Domain Coordinates for d1jrpe4:

Click to download the PDB-style file with coordinates for d1jrpe4.
(The format of our PDB-style files is described here.)

Timeline for d1jrpe4: