SCOPe 2.07: Domain d1jrpe3: 1jrp E:346-462

Lineage for d1jrpe3 (1jrp E:346-462)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)

6. Protein Xanthine dehydrogenase chain A, domain 4 [69772] (1 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [69773] (2 PDB entries)

8. Domain d1jrpe3: 1jrp E:346-462 [67175]
   Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa4, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc4, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe4, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg4, d1jrph1, d1jrph2
   complexed with 141, ca, fad, fes, mos, mte

Details for d1jrpe3

PDB Entry: 1jrp, 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus

PDB Compounds: (E:) xanthine dehydrogenase, chain A

SCOPe Domain Sequences for d1jrpe3:

Sequence; same for both SEQRES and ATOM records:

>d1jrpe3 d.87.2.1 (E:346-462) Xanthine dehydrogenase chain A, domain 4 {Rhodobacter capsulatus [TaxId: 1061]}
pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd
fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp

Timeline for d1jrpe3:

• d1jrpe3 first appeared in SCOP 1.59
  
• d1jrpe3 appears in SCOPe 2.06
  
• d1jrpe3 appears in the current release, SCOPe 2.08