Lineage for d1jrpe1 (1jrp E:85-166)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000915Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2000916Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2000917Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2000966Protein Xanthine dehydrogenase chain A, domain 2 [69040] (1 species)
  7. 2000967Species Rhodobacter capsulatus [TaxId:1061] [69041] (2 PDB entries)
  8. 2000974Domain d1jrpe1: 1jrp E:85-166 [67173]
    Other proteins in same PDB: d1jrpa2, d1jrpa3, d1jrpa4, d1jrpb1, d1jrpb2, d1jrpc2, d1jrpc3, d1jrpc4, d1jrpd1, d1jrpd2, d1jrpe2, d1jrpe3, d1jrpe4, d1jrpf1, d1jrpf2, d1jrpg2, d1jrpg3, d1jrpg4, d1jrph1, d1jrph2
    complexed with 141, ca, fad, fes, mos, mte

Details for d1jrpe1

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
PDB Compounds: (E:) xanthine dehydrogenase, chain A

SCOPe Domain Sequences for d1jrpe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpe1 a.56.1.1 (E:85-166) Xanthine dehydrogenase chain A, domain 2 {Rhodobacter capsulatus [TaxId: 1061]}
dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr
aaeaaageppadwlqadaaftl

SCOPe Domain Coordinates for d1jrpe1:

Click to download the PDB-style file with coordinates for d1jrpe1.
(The format of our PDB-style files is described here.)

Timeline for d1jrpe1: