Lineage for d1jrpe1 (1jrp E:85-166)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153658Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
  4. 153659Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
  5. 153660Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)
  6. 153675Protein Xanthine dehydrogenase chain A, domain 2 [69040] (1 species)
  7. 153676Species Rhodobacter capsulatus [TaxId:1061] [69041] (2 PDB entries)
  8. 153683Domain d1jrpe1: 1jrp E:85-166 [67173]
    Other proteins in same PDB: d1jrpa2, d1jrpa3, d1jrpa4, d1jrpb1, d1jrpb2, d1jrpc2, d1jrpc3, d1jrpc4, d1jrpd1, d1jrpd2, d1jrpe2, d1jrpe3, d1jrpe4, d1jrpf1, d1jrpf2, d1jrpg2, d1jrpg3, d1jrpg4, d1jrph1, d1jrph2

Details for d1jrpe1

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus

SCOP Domain Sequences for d1jrpe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpe1 a.56.1.1 (E:85-166) Xanthine dehydrogenase chain A, domain 2 {Rhodobacter capsulatus}
dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr
aaeaaageppadwlqadaaftl

SCOP Domain Coordinates for d1jrpe1:

Click to download the PDB-style file with coordinates for d1jrpe1.
(The format of our PDB-style files is described here.)

Timeline for d1jrpe1: