Lineage for d1jrpd1 (1jrp D:2-123)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327886Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 327887Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 327888Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 327911Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species)
  7. 327912Species Rhodobacter capsulatus [TaxId:1061] [69692] (2 PDB entries)
  8. 327918Domain d1jrpd1: 1jrp D:2-123 [67171]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa3, d1jrpa4, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc3, d1jrpc4, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe3, d1jrpe4, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg3, d1jrpg4, d1jrph2

Details for d1jrpd1

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus

SCOP Domain Sequences for d1jrpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpd1 d.41.1.1 (D:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus}
svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
pr

SCOP Domain Coordinates for d1jrpd1:

Click to download the PDB-style file with coordinates for d1jrpd1.
(The format of our PDB-style files is described here.)

Timeline for d1jrpd1: