Lineage for d1jrpc3 (1jrp C:346-462)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204289Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2204452Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2204453Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 2204483Protein Xanthine dehydrogenase chain A, domain 4 [69772] (1 species)
  7. 2204484Species Rhodobacter capsulatus [TaxId:1061] [69773] (2 PDB entries)
  8. 2204490Domain d1jrpc3: 1jrp C:346-462 [67169]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa4, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc4, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe4, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg4, d1jrph1, d1jrph2
    complexed with 141, ca, fad, fes, mos, mte

Details for d1jrpc3

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
PDB Compounds: (C:) xanthine dehydrogenase, chain A

SCOPe Domain Sequences for d1jrpc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpc3 d.87.2.1 (C:346-462) Xanthine dehydrogenase chain A, domain 4 {Rhodobacter capsulatus [TaxId: 1061]}
pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd
fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp

SCOPe Domain Coordinates for d1jrpc3:

Click to download the PDB-style file with coordinates for d1jrpc3.
(The format of our PDB-style files is described here.)

Timeline for d1jrpc3: