Lineage for d1jrpb2 (1jrp B:124-777)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137700Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
  4. 137701Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
  5. 137702Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (4 proteins)
  6. 137717Protein Xanthine dehydrogenase chain B, C-terminal domain [69813] (1 species)
  7. 137718Species Rhodobacter capsulatus [TaxId:1061] [69814] (2 PDB entries)
  8. 137723Domain d1jrpb2: 1jrp B:124-777 [67166]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa3, d1jrpa4, d1jrpb1, d1jrpc1, d1jrpc2, d1jrpc3, d1jrpc4, d1jrpd1, d1jrpe1, d1jrpe2, d1jrpe3, d1jrpe4, d1jrpf1, d1jrpg1, d1jrpg2, d1jrpg3, d1jrpg4, d1jrph1

Details for d1jrpb2

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus

SCOP Domain Sequences for d1jrpb2:

Sequence, based on SEQRES records: (download)

>d1jrpb2 d.133.1.1 (B:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtrlqk
sanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnh
ggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmavkda
cetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatgfya
tpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigq
iegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetif
rskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra

Sequence, based on observed residues (ATOM records): (download)

>d1jrpb2 d.133.1.1 (B:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaawns
tnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmvqv
aaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaare
gcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgrpf
lyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwlttee
lvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgisa
flalhdacaacgphwpdlqapatpeavlaavrraegra

SCOP Domain Coordinates for d1jrpb2:

Click to download the PDB-style file with coordinates for d1jrpb2.
(The format of our PDB-style files is described here.)

Timeline for d1jrpb2: