Lineage for d1jrpa4 (1jrp A:179-345)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2223741Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2223742Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2223838Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2223868Protein Xanthine dehydrogenase chain A, domain 3 [69829] (1 species)
  7. 2223869Species Rhodobacter capsulatus [TaxId:1061] [69830] (2 PDB entries)
  8. 2223874Domain d1jrpa4: 1jrp A:179-345 [67164]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa3, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc3, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe3, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg3, d1jrph1, d1jrph2
    complexed with 141, ca, fad, fes, mos, mte

Details for d1jrpa4

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
PDB Compounds: (A:) xanthine dehydrogenase, chain A

SCOPe Domain Sequences for d1jrpa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpa4 d.145.1.3 (A:179-345) Xanthine dehydrogenase chain A, domain 3 {Rhodobacter capsulatus [TaxId: 1061]}
paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp
dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal
iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa

SCOPe Domain Coordinates for d1jrpa4:

Click to download the PDB-style file with coordinates for d1jrpa4.
(The format of our PDB-style files is described here.)

Timeline for d1jrpa4: