Lineage for d1jrpa4 (1jrp A:179-345)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 612464Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 612465Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 612530Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (5 proteins)
  6. 612558Protein Xanthine dehydrogenase chain A, domain 3 [69829] (1 species)
  7. 612559Species Rhodobacter capsulatus [TaxId:1061] [69830] (2 PDB entries)
  8. 612564Domain d1jrpa4: 1jrp A:179-345 [67164]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa3, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc2, d1jrpc3, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe2, d1jrpe3, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg2, d1jrpg3, d1jrph1, d1jrph2

Details for d1jrpa4

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus

SCOP Domain Sequences for d1jrpa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpa4 d.145.1.3 (A:179-345) Xanthine dehydrogenase chain A, domain 3 {Rhodobacter capsulatus}
paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp
dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal
iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa

SCOP Domain Coordinates for d1jrpa4:

Click to download the PDB-style file with coordinates for d1jrpa4.
(The format of our PDB-style files is described here.)

Timeline for d1jrpa4: