Lineage for d1jroh2 (1jro H:124-777)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 2540554Protein Xanthine dehydrogenase chain B, C-terminal domain [69813] (1 species)
  7. 2540555Species Rhodobacter capsulatus [TaxId:1061] [69814] (4 PDB entries)
  8. 2540563Domain d1jroh2: 1jro H:124-777 [67160]
    Other proteins in same PDB: d1jroa1, d1jroa2, d1jroa3, d1jroa4, d1jrob1, d1jroc1, d1jroc2, d1jroc3, d1jroc4, d1jrod1, d1jroe1, d1jroe2, d1jroe3, d1jroe4, d1jrof1, d1jrog1, d1jrog2, d1jrog3, d1jrog4, d1jroh1
    complexed with ca, fad, fes, mos, mte

Details for d1jroh2

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (H:) xanthine dehydrogenase, chain B

SCOPe Domain Sequences for d1jroh2:

Sequence, based on SEQRES records: (download)

>d1jroh2 d.133.1.1 (H:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtrlqk
sanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnh
ggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmavkda
cetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatgfya
tpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigq
iegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetif
rskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra

Sequence, based on observed residues (ATOM records): (download)

>d1jroh2 d.133.1.1 (H:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaawns
tnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmvqv
aaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaare
gcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgrpf
lyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwlttee
lvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgisa
flalhdacaacgphwpdlqapatpeavlaavrraegra

SCOPe Domain Coordinates for d1jroh2:

Click to download the PDB-style file with coordinates for d1jroh2.
(The format of our PDB-style files is described here.)

Timeline for d1jroh2: