Lineage for d1jroh1 (1jro H:2-123)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024467Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1024468Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 1024469Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 1024505Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species)
  7. 1024506Species Rhodobacter capsulatus [TaxId:1061] [69692] (2 PDB entries)
  8. 1024510Domain d1jroh1: 1jro H:2-123 [67159]
    Other proteins in same PDB: d1jroa1, d1jroa2, d1jroa3, d1jroa4, d1jrob2, d1jroc1, d1jroc2, d1jroc3, d1jroc4, d1jrod2, d1jroe1, d1jroe2, d1jroe3, d1jroe4, d1jrof2, d1jrog1, d1jrog2, d1jrog3, d1jrog4, d1jroh2
    complexed with ca, fad, fes, mos, mpn

Details for d1jroh1

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (H:) xanthine dehydrogenase, chain B

SCOPe Domain Sequences for d1jroh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jroh1 d.41.1.1 (H:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
pr

SCOPe Domain Coordinates for d1jroh1:

Click to download the PDB-style file with coordinates for d1jroh1.
(The format of our PDB-style files is described here.)

Timeline for d1jroh1: