Lineage for d1jroh1 (1jro H:2-123)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191221Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 191222Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 191223Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 191238Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species)
  7. 191239Species Rhodobacter capsulatus [TaxId:1061] [69692] (2 PDB entries)
  8. 191243Domain d1jroh1: 1jro H:2-123 [67159]
    Other proteins in same PDB: d1jroa1, d1jroa2, d1jroa3, d1jroa4, d1jrob2, d1jroc1, d1jroc2, d1jroc3, d1jroc4, d1jrod2, d1jroe1, d1jroe2, d1jroe3, d1jroe4, d1jrof2, d1jrog1, d1jrog2, d1jrog3, d1jrog4, d1jroh2

Details for d1jroh1

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (H:)

SCOP Domain Sequences for d1jroh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jroh1 d.41.1.1 (H:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus}
svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
pr

SCOP Domain Coordinates for d1jroh1:

Click to download the PDB-style file with coordinates for d1jroh1.
(The format of our PDB-style files is described here.)

Timeline for d1jroh1: