Lineage for d1jrof1 (1jro F:2-123)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256251Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 256252Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 256253Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 256276Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species)
  7. 256277Species Rhodobacter capsulatus [TaxId:1061] [69692] (2 PDB entries)
  8. 256280Domain d1jrof1: 1jro F:2-123 [67153]
    Other proteins in same PDB: d1jroa1, d1jroa2, d1jroa3, d1jroa4, d1jrob2, d1jroc1, d1jroc2, d1jroc3, d1jroc4, d1jrod2, d1jroe1, d1jroe2, d1jroe3, d1jroe4, d1jrof2, d1jrog1, d1jrog2, d1jrog3, d1jrog4, d1jroh2

Details for d1jrof1

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus

SCOP Domain Sequences for d1jrof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrof1 d.41.1.1 (F:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus}
svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
pr

SCOP Domain Coordinates for d1jrof1:

Click to download the PDB-style file with coordinates for d1jrof1.
(The format of our PDB-style files is described here.)

Timeline for d1jrof1: