Lineage for d1jroe4 (1jro E:179-345)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197501Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 197502Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 197553Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (3 proteins)
  6. 197563Protein Xanthine dehydrogenase chain A, domain 3 [69829] (1 species)
  7. 197564Species Rhodobacter capsulatus [TaxId:1061] [69830] (2 PDB entries)
  8. 197567Domain d1jroe4: 1jro E:179-345 [67152]
    Other proteins in same PDB: d1jroa1, d1jroa2, d1jroa3, d1jrob1, d1jrob2, d1jroc1, d1jroc2, d1jroc3, d1jrod1, d1jrod2, d1jroe1, d1jroe2, d1jroe3, d1jrof1, d1jrof2, d1jrog1, d1jrog2, d1jrog3, d1jroh1, d1jroh2

Details for d1jroe4

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (E:)

SCOP Domain Sequences for d1jroe4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jroe4 d.145.1.3 (E:179-345) Xanthine dehydrogenase chain A, domain 3 {Rhodobacter capsulatus}
paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp
dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal
iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa

SCOP Domain Coordinates for d1jroe4:

Click to download the PDB-style file with coordinates for d1jroe4.
(The format of our PDB-style files is described here.)

Timeline for d1jroe4: