Lineage for d1jrod2 (1jro D:124-777)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137700Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
  4. 137701Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
  5. 137702Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (4 proteins)
  6. 137717Protein Xanthine dehydrogenase chain B, C-terminal domain [69813] (1 species)
  7. 137718Species Rhodobacter capsulatus [TaxId:1061] [69814] (2 PDB entries)
  8. 137720Domain d1jrod2: 1jro D:124-777 [67148]
    Other proteins in same PDB: d1jroa1, d1jroa2, d1jroa3, d1jroa4, d1jrob1, d1jroc1, d1jroc2, d1jroc3, d1jroc4, d1jrod1, d1jroe1, d1jroe2, d1jroe3, d1jroe4, d1jrof1, d1jrog1, d1jrog2, d1jrog3, d1jrog4, d1jroh1

Details for d1jrod2

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (D:)

SCOP Domain Sequences for d1jrod2:

Sequence, based on SEQRES records: (download)

>d1jrod2 d.133.1.1 (D:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtrlqk
sanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnh
ggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmavkda
cetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatgfya
tpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigq
iegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetif
rskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra

Sequence, based on observed residues (ATOM records): (download)

>d1jrod2 d.133.1.1 (D:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaawns
tnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmvqv
aaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaare
gcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgrpf
lyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwlttee
lvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgisa
flalhdacaacgphwpdlqapatpeavlaavrraegra

SCOP Domain Coordinates for d1jrod2:

Click to download the PDB-style file with coordinates for d1jrod2.
(The format of our PDB-style files is described here.)

Timeline for d1jrod2: