Lineage for d1jroc3 (1jro C:346-462)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194320Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 194432Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 194433Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (3 proteins)
  6. 194443Protein Xanthine dehydrogenase chain A, domain 4 [69772] (1 species)
  7. 194444Species Rhodobacter capsulatus [TaxId:1061] [69773] (2 PDB entries)
  8. 194446Domain d1jroc3: 1jro C:346-462 [67145]
    Other proteins in same PDB: d1jroa1, d1jroa2, d1jroa4, d1jrob1, d1jrob2, d1jroc1, d1jroc2, d1jroc4, d1jrod1, d1jrod2, d1jroe1, d1jroe2, d1jroe4, d1jrof1, d1jrof2, d1jrog1, d1jrog2, d1jrog4, d1jroh1, d1jroh2

Details for d1jroc3

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (C:)

SCOP Domain Sequences for d1jroc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jroc3 d.87.2.1 (C:346-462) Xanthine dehydrogenase chain A, domain 4 {Rhodobacter capsulatus}
pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd
fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp

SCOP Domain Coordinates for d1jroc3:

Click to download the PDB-style file with coordinates for d1jroc3.
(The format of our PDB-style files is described here.)

Timeline for d1jroc3: