Lineage for d1jroc2 (1jro C:1-84)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 131113Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (8 proteins)
  6. 131152Protein Xanthine dehydrogenase chain A, N-terminal domain [69666] (1 species)
  7. 131153Species Rhodobacter capsulatus [TaxId:1061] [69667] (2 PDB entries)
  8. 131155Domain d1jroc2: 1jro C:1-84 [67144]
    Other proteins in same PDB: d1jroa1, d1jroa3, d1jroa4, d1jrob1, d1jrob2, d1jroc1, d1jroc3, d1jroc4, d1jrod1, d1jrod2, d1jroe1, d1jroe3, d1jroe4, d1jrof1, d1jrof2, d1jrog1, d1jrog3, d1jrog4, d1jroh1, d1jroh2

Details for d1jroc2

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (C:)

SCOP Domain Sequences for d1jroc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jroc2 d.15.4.2 (C:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus}
meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
naclmmlpqiagkalrtiegiaap

SCOP Domain Coordinates for d1jroc2:

Click to download the PDB-style file with coordinates for d1jroc2.
(The format of our PDB-style files is described here.)

Timeline for d1jroc2: