Lineage for d1jroc1 (1jro C:85-166)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153658Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
  4. 153659Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
  5. 153660Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)
  6. 153675Protein Xanthine dehydrogenase chain A, domain 2 [69040] (1 species)
  7. 153676Species Rhodobacter capsulatus [TaxId:1061] [69041] (2 PDB entries)
  8. 153678Domain d1jroc1: 1jro C:85-166 [67143]
    Other proteins in same PDB: d1jroa2, d1jroa3, d1jroa4, d1jrob1, d1jrob2, d1jroc2, d1jroc3, d1jroc4, d1jrod1, d1jrod2, d1jroe2, d1jroe3, d1jroe4, d1jrof1, d1jrof2, d1jrog2, d1jrog3, d1jrog4, d1jroh1, d1jroh2

Details for d1jroc1

PDB Entry: 1jro (more details), 2.7 Å

PDB Description: crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
PDB Compounds: (C:)

SCOP Domain Sequences for d1jroc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jroc1 a.56.1.1 (C:85-166) Xanthine dehydrogenase chain A, domain 2 {Rhodobacter capsulatus}
dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr
aaeaaageppadwlqadaaftl

SCOP Domain Coordinates for d1jroc1:

Click to download the PDB-style file with coordinates for d1jroc1.
(The format of our PDB-style files is described here.)

Timeline for d1jroc1: