Lineage for d1jrma_ (1jrm A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944307Fold d.206: YggU-like [69785] (1 superfamily)
    beta(2)-loop-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243; some similarity to the Homing endonuclease-like fold
  4. 1944308Superfamily d.206.1: YggU-like [69786] (1 family) (S)
  5. 1944309Family d.206.1.1: YggU-like [69787] (2 proteins)
  6. 1944310Protein Hypothetical protein MTH637 [69788] (1 species)
  7. 1944311Species Methanobacterium thermoautotrophicum [TaxId:145262] [69789] (1 PDB entry)
  8. 1944312Domain d1jrma_: 1jrm A: [67136]
    structural genomics

Details for d1jrma_

PDB Entry: 1jrm (more details)

PDB Description: NMR structure of MTH0637. Ontario Centre for Structural Proteomics target MTH0637_1_104; Northeast Structural Genomics Target TT135
PDB Compounds: (A:) CONSERVED HYPOTHETICAL PROTEIN mth637

SCOPe Domain Sequences for d1jrma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrma_ d.206.1.1 (A:) Hypothetical protein MTH637 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vitmdclrevgddllvnievspasgkfgipsynewrkrievkihsppqkgkanreiikef
setfgrdveivsgqksrqktiriqgmgrdlflklvsekfgleip

SCOPe Domain Coordinates for d1jrma_:

Click to download the PDB-style file with coordinates for d1jrma_.
(The format of our PDB-style files is described here.)

Timeline for d1jrma_: