Lineage for d1jrma_ (1jrm A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 140330Fold d.206: Hypothetical protein MTH637 [69785] (1 superfamily)
  4. 140331Superfamily d.206.1: Hypothetical protein MTH637 [69786] (1 family) (S)
  5. 140332Family d.206.1.1: Hypothetical protein MTH637 [69787] (1 protein)
  6. 140333Protein Hypothetical protein MTH637 [69788] (1 species)
  7. 140334Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [69789] (1 PDB entry)
  8. 140335Domain d1jrma_: 1jrm A: [67136]

Details for d1jrma_

PDB Entry: 1jrm (more details)

PDB Description: NMR structure of MTH0637. Ontario Centre for Structural Proteomics target MTH0637_1_104; Northeast Structural Genomics Target TT135

SCOP Domain Sequences for d1jrma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrma_ d.206.1.1 (A:) Hypothetical protein MTH637 {Archaeon Methanobacterium thermoautotrophicum}
vitmdclrevgddllvnievspasgkfgipsynewrkrievkihsppqkgkanreiikef
setfgrdveivsgqksrqktiriqgmgrdlflklvsekfgleip

SCOP Domain Coordinates for d1jrma_:

Click to download the PDB-style file with coordinates for d1jrma_.
(The format of our PDB-style files is described here.)

Timeline for d1jrma_: