Lineage for d1jrma_ (1jrm A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.206: Hypothetical protein MTH637 [69785] (1 superfamily) Superfamily d.206.1: Hypothetical protein MTH637 [69786] (1 family) 
Family d.206.1.1: Hypothetical protein MTH637 [69787] (1 protein) Protein Hypothetical protein MTH637 [69788] (1 species) Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [69789] (1 PDB entry) 
Domain d1jrma_: 1jrm A: [67136]
Details for d1jrma_
PDB Entry: 1jrm (more details)
PDB Description: nmr structure of mth0637. ontario centre for structural proteomics target mth0637_1_104; northeast structural genomics target tt135
SCOP Domain Sequences for d1jrma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrma_ d.206.1.1 (A:) Hypothetical protein MTH637 {Archaeon Methanobacterium thermoautotrophicum}
vitmdclrevgddllvnievspasgkfgipsynewrkrievkihsppqkgkanreiikef
setfgrdveivsgqksrqktiriqgmgrdlflklvsekfgleip
SCOP Domain Coordinates for d1jrma_:
Click to download the PDB-style file with coordinates for d1jrma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jrma_:
- d1jrma_ is new in SCOP 1.59
- d1jrma_ appears in SCOP 1.61
- d1jrma_ appears in the current release, SCOPe 2.08, called d1jrma1
View in 3D