Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.206: YggU-like [69785] (1 superfamily) beta(2)-loop-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243; some similarity to the Homing endonuclease-like fold |
Superfamily d.206.1: YggU-like [69786] (1 family) |
Family d.206.1.1: YggU-like [69787] (2 proteins) |
Protein Hypothetical protein MTH637 [69788] (1 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [69789] (1 PDB entry) |
Domain d1jrma1: 1jrm A:2-104 [67136] Other proteins in same PDB: d1jrma2 structural genomics |
PDB Entry: 1jrm (more details)
SCOPe Domain Sequences for d1jrma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrma1 d.206.1.1 (A:2-104) Hypothetical protein MTH637 {Methanobacterium thermoautotrophicum [TaxId: 145262]} itmdclrevgddllvnievspasgkfgipsynewrkrievkihsppqkgkanreiikefs etfgrdveivsgqksrqktiriqgmgrdlflklvsekfgleip
Timeline for d1jrma1: