Lineage for d1jrja_ (1jrj A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2650458Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 2650459Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 2650460Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 2650476Protein Exendin-4 [70005] (1 species)
    glucagone-like hormone
  7. 2650477Species Synthetic [70006] (3 PDB entries)
  8. 2650480Domain d1jrja_: 1jrj A: [67135]

Details for d1jrja_

PDB Entry: 1jrj (more details)

PDB Description: solution structure of exendin-4 in 30-vol% trifluoroethanol
PDB Compounds: (A:) Exendin-4

SCOPe Domain Sequences for d1jrja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrja_ j.6.1.1 (A:) Exendin-4 {Synthetic}
hgegtftsdlskqmeeeavrlfiewlknggpssgappps

SCOPe Domain Coordinates for d1jrja_:

Click to download the PDB-style file with coordinates for d1jrja_.
(The format of our PDB-style files is described here.)

Timeline for d1jrja_: