Lineage for d1jril_ (1jri L:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1786640Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1786641Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1786687Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 1786734Domain d1jril_: 1jri L: [67132]
    complexed with cl, edo

Details for d1jril_

PDB Entry: 1jri (more details), 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.
PDB Compounds: (L:) Sm-like Archaeal Protein 1 (SmAP1)

SCOPe Domain Sequences for d1jril_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jril_ b.38.1.1 (L:) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
vlirgdnivyisrgkl

SCOPe Domain Coordinates for d1jril_:

Click to download the PDB-style file with coordinates for d1jril_.
(The format of our PDB-style files is described here.)

Timeline for d1jril_: