Lineage for d1jrig_ (1jri G:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558695Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 558696Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 558697Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins)
    forms homo and heteroheptameric ring structures
  6. 558698Protein Archaeal homoheptameric Sm protein [63758] (5 species)
  7. 558744Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 558786Domain d1jrig_: 1jri G: [67127]

Details for d1jrig_

PDB Entry: 1jri (more details), 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.

SCOP Domain Sequences for d1jrig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrig_ b.38.1.1 (G:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
vlirgdnivyisrgkl

SCOP Domain Coordinates for d1jrig_:

Click to download the PDB-style file with coordinates for d1jrig_.
(The format of our PDB-style files is described here.)

Timeline for d1jrig_: