Lineage for d1jrad_ (1jra D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279291Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 279560Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (1 family) (S)
  5. 279561Family a.24.15.1: FAD-dependent thiol oxidase [69001] (2 proteins)
  6. 279568Protein Thiol oxidase Erv2p [69002] (1 species)
  7. 279569Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69003] (2 PDB entries)
  8. 279575Domain d1jrad_: 1jra D: [67120]
    complexed with fad

Details for d1jrad_

PDB Entry: 1jra (more details), 2 Å

PDB Description: Crystal Structure of Erv2p

SCOP Domain Sequences for d1jrad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrad_ a.24.15.1 (D:) Thiol oxidase Erv2p {Baker's yeast (Saccharomyces cerevisiae)}
kvkkevgraswkyfhtllarfpdeptpeereklhtfiglyaelypcgecsyhfvklieky
pvqtssrtaaamwgchihnkvneylkkdiydcatiledydcgc

SCOP Domain Coordinates for d1jrad_:

Click to download the PDB-style file with coordinates for d1jrad_.
(The format of our PDB-style files is described here.)

Timeline for d1jrad_: