SCOP 1.67: Domain d1jrab_: 1jra B:

Lineage for d1jrab_ (1jra B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (1 family)

5. Family a.24.15.1: FAD-dependent thiol oxidase [69001] (2 proteins)

6. Protein Thiol oxidase Erv2p [69002] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69003] (2 PDB entries)

8. Domain d1jrab_: 1jra B: [67118]

Details for d1jrab_

PDB Entry: 1jra, 2 Å

PDB Description: Crystal Structure of Erv2p

SCOP Domain Sequences for d1jrab_:

Sequence; same for both SEQRES and ATOM records:

>d1jrab_ a.24.15.1 (B:) Thiol oxidase Erv2p {Baker's yeast (Saccharomyces cerevisiae)}
ddkvkkevgraswkyfhtllarfpdeptpeereklhtfiglyaelypcgecsyhfvklie
kypvqtssrtaaamwgchihnkvneylkkdiydcatiledydcgcs

Timeline for d1jrab_:

• d1jrab_ first appeared in SCOP 1.59
  
• d1jrab_ appears in SCOP 1.65
  
• d1jrab_ appears in SCOP 1.69
  
• d1jrab_ appears in the current release, SCOPe 2.08