SCOPe 2.06: Domain d1jr8b_: 1jr8 B:

Lineage for d1jr8b_ (1jr8 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)

6. Protein Thiol oxidase Erv2p [69002] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69003] (2 PDB entries)

8. Domain d1jr8b_: 1jr8 B: [67116]
   complexed with fad

Details for d1jr8b_

PDB Entry: 1jr8, 1.5 Å

PDB Description: Crystal Structure of Erv2p

PDB Compounds: (B:) Erv2 PROTEIN, mitochondrial

SCOPe Domain Sequences for d1jr8b_:

Sequence; same for both SEQRES and ATOM records:

>d1jr8b_ a.24.15.1 (B:) Thiol oxidase Erv2p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dkvkkevgraswkyfhtllarfpdeptpeereklhtfiglyaelypcgecsyhfvkliek
ypvqtssrtaaamwgchihnkvneylkkdiydcatiledydcgcs

Timeline for d1jr8b_:

• d1jr8b_ first appeared in SCOP 1.59
  
• d1jr8b_ appears in SCOPe 2.05
  
• d1jr8b_ appears in SCOPe 2.07
  
• d1jr8b_ appears in the current release, SCOPe 2.08