SCOPe 2.07: Domain d1jr5b_: 1jr5 B:

Lineage for d1jr5b_ (1jr5 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.150: Anti-sigma factor AsiA [69069] (1 superfamily)
   core: 5 helices: orthogonal array

4. Superfamily a.150.1: Anti-sigma factor AsiA [69070] (1 family)

5. Family a.150.1.1: Anti-sigma factor AsiA [69071] (1 protein)

6. Protein Anti-sigma factor AsiA [69072] (2 species)

7. Species Bacteriophage T4 [TaxId:10665] [69073] (4 PDB entries)
   Uniprot P32267

8. Domain d1jr5b_: 1jr5 B: [67114]

Details for d1jr5b_

PDB Entry: 1jr5

PDB Description: solution structure of the anti-sigma factor asia homodimer

PDB Compounds: (B:) 10 KDA Anti-Sigma Factor

SCOPe Domain Sequences for d1jr5b_:

Sequence; same for both SEQRES and ATOM records:

>d1jr5b_ a.150.1.1 (B:) Anti-sigma factor AsiA {Bacteriophage T4 [TaxId: 10665]}
mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
ltqedkktlidefnegfegvyrylemytnk

Timeline for d1jr5b_:

• d1jr5b_ first appeared in SCOP 1.59
  
• d1jr5b_ appears in SCOPe 2.06
  
• d1jr5b_ appears in the current release, SCOPe 2.08