Lineage for d1jr5b_ (1jr5 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751913Fold a.150: Anti-sigma factor AsiA [69069] (1 superfamily)
    core: 5 helices: orthogonal array
  4. 1751914Superfamily a.150.1: Anti-sigma factor AsiA [69070] (1 family) (S)
  5. 1751915Family a.150.1.1: Anti-sigma factor AsiA [69071] (1 protein)
  6. 1751916Protein Anti-sigma factor AsiA [69072] (1 species)
  7. 1751917Species Bacteriophage T4 [TaxId:10665] [69073] (4 PDB entries)
    Uniprot P32267
  8. 1751923Domain d1jr5b_: 1jr5 B: [67114]

Details for d1jr5b_

PDB Entry: 1jr5 (more details)

PDB Description: solution structure of the anti-sigma factor asia homodimer
PDB Compounds: (B:) 10 KDA Anti-Sigma Factor

SCOPe Domain Sequences for d1jr5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr5b_ a.150.1.1 (B:) Anti-sigma factor AsiA {Bacteriophage T4 [TaxId: 10665]}
mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
ltqedkktlidefnegfegvyrylemytnk

SCOPe Domain Coordinates for d1jr5b_:

Click to download the PDB-style file with coordinates for d1jr5b_.
(The format of our PDB-style files is described here.)

Timeline for d1jr5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jr5a_