Lineage for d1jr5b_ (1jr5 B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101893Fold a.150: Anti-sigma factor Asia [69069] (1 superfamily)
  4. 101894Superfamily a.150.1: Anti-sigma factor Asia [69070] (1 family) (S)
  5. 101895Family a.150.1.1: Anti-sigma factor Asia [69071] (1 protein)
  6. 101896Protein Anti-sigma factor Asia [69072] (1 species)
  7. 101897Species Bacteriophage T4 [TaxId:10665] [69073] (1 PDB entry)
  8. 101899Domain d1jr5b_: 1jr5 B: [67114]

Details for d1jr5b_

PDB Entry: 1jr5 (more details)

PDB Description: solution structure of the anti-sigma factor asia homodimer

SCOP Domain Sequences for d1jr5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr5b_ a.150.1.1 (B:) Anti-sigma factor Asia {Bacteriophage T4}
mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
ltqedkktlidefnegfegvyrylemytnk

SCOP Domain Coordinates for d1jr5b_:

Click to download the PDB-style file with coordinates for d1jr5b_.
(The format of our PDB-style files is described here.)

Timeline for d1jr5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jr5a_