Lineage for d1jr5a_ (1jr5 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348112Fold a.150: Anti-sigma factor AsiA [69069] (1 superfamily)
    core: 5 helices: orthogonal array
  4. 2348113Superfamily a.150.1: Anti-sigma factor AsiA [69070] (1 family) (S)
  5. 2348114Family a.150.1.1: Anti-sigma factor AsiA [69071] (1 protein)
  6. 2348115Protein Anti-sigma factor AsiA [69072] (2 species)
  7. 2348116Species Bacteriophage T4 [TaxId:10665] [69073] (4 PDB entries)
    Uniprot P32267
  8. 2348121Domain d1jr5a_: 1jr5 A: [67113]

Details for d1jr5a_

PDB Entry: 1jr5 (more details)

PDB Description: solution structure of the anti-sigma factor asia homodimer
PDB Compounds: (A:) 10 KDA Anti-Sigma Factor

SCOPe Domain Sequences for d1jr5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr5a_ a.150.1.1 (A:) Anti-sigma factor AsiA {Bacteriophage T4 [TaxId: 10665]}
mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
ltqedkktlidefnegfegvyrylemytnk

SCOPe Domain Coordinates for d1jr5a_:

Click to download the PDB-style file with coordinates for d1jr5a_.
(The format of our PDB-style files is described here.)

Timeline for d1jr5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jr5b_