SCOPe 2.02: Domain d1jqwa_: 1jqw A:

Lineage for d1jqwa_ (1jqw A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
   contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)

6. Protein Autoinducer-2 production protein LuxS [64295] (4 species)
   S-ribosylhomocysteinase

7. Species Bacillus subtilis [TaxId:1423] [64296] (7 PDB entries)

8. Domain d1jqwa_: 1jqw A: [67108]
   complexed with hcs, zn

Details for d1jqwa_

PDB Entry: 1jqw, 2.3 Å

PDB Description: the 2.3 angstrom resolution structure of bacillus subtilis luxs/homocysteine complex

PDB Compounds: (A:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1jqwa_:

Sequence; same for both SEQRES and ATOM records:

>d1jqwa_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Bacillus subtilis [TaxId: 1423]}
eldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaftirsh
aekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipaanekqcg
qaklhdlegakrlmrfwlsqdkeellkvfg

Timeline for d1jqwa_:

• d1jqwa_ first appeared in SCOP 1.59
  
• d1jqwa_ appears in SCOPe 2.01
  
• d1jqwa_ appears in SCOPe 2.03
  
• d1jqwa_ appears in the current release, SCOPe 2.08