Lineage for d1jqra_ (1jqr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3006901Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 3007130Protein DNA polymerase X [69885] (1 species)
  7. 3007131Species African swine fever virus [TaxId:10497] [69886] (6 PDB entries)
  8. 3007137Domain d1jqra_: 1jqr A: [67107]

Details for d1jqra_

PDB Entry: 1jqr (more details)

PDB Description: nmr structure of the african swine fever virus dna polymerase x
PDB Compounds: (A:) DNA polymerase beta-like

SCOPe Domain Sequences for d1jqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqra_ d.218.1.2 (A:) DNA polymerase X {African swine fever virus [TaxId: 10497]}
mltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliivpekk
llkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftgpv
syliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl

SCOPe Domain Coordinates for d1jqra_:

Click to download the PDB-style file with coordinates for d1jqra_.
(The format of our PDB-style files is described here.)

Timeline for d1jqra_: