Lineage for d1jqjd2 (1jqj D:1-209)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 485481Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 485532Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species)
  7. 485533Species Escherichia coli [TaxId:562] [64034] (3 PDB entries)
  8. 485537Domain d1jqjd2: 1jqj D:1-209 [67100]
    Other proteins in same PDB: d1jqja1, d1jqja2, d1jqja3, d1jqjb1, d1jqjb2, d1jqjb3, d1jqjc1, d1jqjd1

Details for d1jqjd2

PDB Entry: 1jqj (more details), 2.9 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of the beta-delta complex

SCOP Domain Sequences for d1jqjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqjd2 c.37.1.20 (D:1-209) delta subunit of DNA polymerase III, N-domain {Escherichia coli}
mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
laqalerlsllwpdgkltlprveqavnda

SCOP Domain Coordinates for d1jqjd2:

Click to download the PDB-style file with coordinates for d1jqjd2.
(The format of our PDB-style files is described here.)

Timeline for d1jqjd2: